Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.5: Mitochondrial cytochrome c oxidase subunit VIIb [81423] (1 family) automatically mapped to Pfam PF05392 |
Family f.23.5.1: Mitochondrial cytochrome c oxidase subunit VIIb [81422] (2 proteins) |
Protein automated matches [190272] (1 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [187064] (26 PDB entries) |
Domain d3ag1x_: 3ag1 X: [172065] Other proteins in same PDB: d3ag1a_, d3ag1b1, d3ag1b2, d3ag1c_, d3ag1d_, d3ag1e_, d3ag1f_, d3ag1g_, d3ag1h_, d3ag1i_, d3ag1j_, d3ag1l_, d3ag1m_, d3ag1n_, d3ag1o1, d3ag1o2, d3ag1p_, d3ag1q_, d3ag1r_, d3ag1s_, d3ag1t_, d3ag1u_, d3ag1v_, d3ag1w_, d3ag1y_, d3ag1z_ automated match to d1occk_ complexed with cdl, chd, cmo, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 3ag1 (more details), 2.2 Å
SCOPe Domain Sequences for d3ag1x_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ag1x_ f.23.5.1 (X:) automated matches {Cow (Bos taurus) [TaxId: 9913]} apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr
Timeline for d3ag1x_:
View in 3D Domains from other chains: (mouse over for more information) d3ag1a_, d3ag1b1, d3ag1b2, d3ag1c_, d3ag1d_, d3ag1e_, d3ag1f_, d3ag1g_, d3ag1h_, d3ag1i_, d3ag1j_, d3ag1k_, d3ag1l_, d3ag1m_, d3ag1n_, d3ag1o1, d3ag1o2, d3ag1p_, d3ag1q_, d3ag1r_, d3ag1s_, d3ag1t_, d3ag1u_, d3ag1v_, d3ag1w_, d3ag1y_, d3ag1z_ |