SCOPe 2.05: Domain d3ag1t_: 3ag1 T:

Lineage for d3ag1t_ (3ag1 T:)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (40 superfamilies)
   not a true fold

4. Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family)
   automatically mapped to Pfam PF02046

5. Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (2 proteins)

6. Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species)
   probably responsible for the dimerization of the mitochondrial cytochrome c oxidase

7. Species Cow (Bos taurus) [TaxId:9913] [81408] (26 PDB entries)

8. Domain d3ag1t_: 3ag1 T: [172061]
   Other proteins in same PDB: d3ag1a_, d3ag1b1, d3ag1b2, d3ag1c_, d3ag1d_, d3ag1e_, d3ag1f_, d3ag1h_, d3ag1i_, d3ag1j_, d3ag1k_, d3ag1l_, d3ag1m_, d3ag1n_, d3ag1o1, d3ag1o2, d3ag1p_, d3ag1q_, d3ag1r_, d3ag1s_, d3ag1u_, d3ag1v_, d3ag1w_, d3ag1x_, d3ag1y_, d3ag1z_
   automated match to d1occg_
   complexed with cdl, chd, cmo, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d3ag1t_

PDB Entry: 3ag1, 2.2 Å

PDB Description: Bovine Heart Cytochrome c Oxidase in the Carbon Monoxide-bound Fully Reduced State at 280 K

PDB Compounds: (T:) Cytochrome c oxidase subunit 6A2

SCOPe Domain Sequences for d3ag1t_:

Sequence; same for both SEQRES and ATOM records:

>d3ag1t_ f.23.2.1 (T:) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]}
asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
swgdgnhtffhnprvnplptgyek

Timeline for d3ag1t_:

• d3ag1t_ first appeared in SCOPe 2.01
  
• d3ag1t_ appears in SCOPe 2.04
  
• d3ag1t_ appears in SCOPe 2.06
  
• d3ag1t_ appears in the current release, SCOPe 2.08