SCOPe 2.04: Domain d3ag1s_: 3ag1 S:

Lineage for d3ag1s_ (3ag1 S:)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.5: Rubredoxin-like [57802] (4 families)

5. Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (2 proteins)
   membrane-anchored rubredoxin-like domain
   automatically mapped to Pfam PF01215

6. Protein Cytochrome c oxidase Subunit F [57819] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [57820] (25 PDB entries)

8. Domain d3ag1s_: 3ag1 S: [172060]
   Other proteins in same PDB: d3ag1a_, d3ag1b1, d3ag1b2, d3ag1c_, d3ag1d_, d3ag1e_, d3ag1g_, d3ag1h_, d3ag1i_, d3ag1j_, d3ag1k_, d3ag1l_, d3ag1m_, d3ag1n_, d3ag1o1, d3ag1o2, d3ag1p_, d3ag1q_, d3ag1r_, d3ag1t_, d3ag1u_, d3ag1v_, d3ag1w_, d3ag1x_, d3ag1y_, d3ag1z_
   automated match to d1occf_
   complexed with cdl, chd, cmo, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d3ag1s_

PDB Entry: 3ag1, 2.2 Å

PDB Description: Bovine Heart Cytochrome c Oxidase in the Carbon Monoxide-bound Fully Reduced State at 280 K

PDB Compounds: (S:) Cytochrome c oxidase subunit 5B

SCOPe Domain Sequences for d3ag1s_:

Sequence; same for both SEQRES and ATOM records:

>d3ag1s_ g.41.5.3 (S:) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]}
asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
iceednstviwfwlhkgeaqrcpscgthyklvphqlah

Timeline for d3ag1s_:

• d3ag1s_ first appeared in SCOPe 2.01
  
• d3ag1s_ appears in SCOPe 2.03
  
• d3ag1s_ appears in SCOPe 2.05
  
• d3ag1s_ appears in the current release, SCOPe 2.08