Lineage for d1pvb__ (1pvb -)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 213166Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 213167Superfamily a.39.1: EF-hand [47473] (9 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 213286Family a.39.1.4: Parvalbumin [47492] (2 proteins)
    6-helices; array of 3 hairpins, closed
    made with two-helical hairpin and two EF-hands
  6. 213291Protein Parvalbumin [47495] (6 species)
  7. 213303Species Pike (Esox lucius) [TaxId:8010] [47497] (9 PDB entries)
  8. 213305Domain d1pvb__: 1pvb - [17206]
    complexed with ca, nh4

Details for d1pvb__

PDB Entry: 1pvb (more details), 1.75 Å

PDB Description: x-ray structure of a new crystal form of pike 4.10 parvalbumin

SCOP Domain Sequences for d1pvb__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pvb__ a.39.1.4 (-) Parvalbumin {Pike (Esox lucius)}
sfaglkdadvaaalaacsaadsfkhkeffakvglaskslddvkkafyvidqdksgfieed
elklflqnfspsaraltdaetkafladgdkdgdgmigvdefaamika

SCOP Domain Coordinates for d1pvb__:

Click to download the PDB-style file with coordinates for d1pvb__.
(The format of our PDB-style files is described here.)

Timeline for d1pvb__: