Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
Superfamily f.23.3: Mitochondrial cytochrome c oxidase subunit VIc [81415] (1 family) |
Family f.23.3.1: Mitochondrial cytochrome c oxidase subunit VIc [81414] (1 protein) |
Protein Mitochondrial cytochrome c oxidase subunit VIc [81413] (1 species) function unknown, probably acts as a regulator or is required for the assembly |
Species Cow (Bos taurus) [TaxId:9913] [81412] (24 PDB entries) |
Domain d3ag1i_: 3ag1 I: [172051] Other proteins in same PDB: d3ag1a_, d3ag1c_, d3ag1d_, d3ag1e_, d3ag1f_, d3ag1g_, d3ag1h_, d3ag1j_, d3ag1k_, d3ag1l_, d3ag1m_, d3ag1n_, d3ag1p_, d3ag1q_, d3ag1r_, d3ag1s_, d3ag1t_, d3ag1u_, d3ag1w_, d3ag1x_, d3ag1y_, d3ag1z_ automated match to d1occi_ complexed with cdl, chd, cmo, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 3ag1 (more details), 2.2 Å
SCOPe Domain Sequences for d3ag1i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ag1i_ f.23.3.1 (I:) Mitochondrial cytochrome c oxidase subunit VIc {Cow (Bos taurus) [TaxId: 9913]} stalakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdf eemrkagifqsak
Timeline for d3ag1i_: