| Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.1: Mitochondrial cytochrome c oxidase subunit IV [81406] (1 family) ![]() automatically mapped to Pfam PF02936 |
| Family f.23.1.1: Mitochondrial cytochrome c oxidase subunit IV [81405] (2 proteins) |
| Protein automated matches [190270] (1 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [187062] (19 PDB entries) |
| Domain d3ag1d_: 3ag1 D: [172046] Other proteins in same PDB: d3ag1a_, d3ag1b1, d3ag1b2, d3ag1c_, d3ag1e_, d3ag1f_, d3ag1g_, d3ag1h_, d3ag1i_, d3ag1j_, d3ag1k_, d3ag1l_, d3ag1m_, d3ag1n_, d3ag1o1, d3ag1o2, d3ag1p_, d3ag1r_, d3ag1s_, d3ag1t_, d3ag1u_, d3ag1v_, d3ag1w_, d3ag1x_, d3ag1y_, d3ag1z_ automated match to d1occd_ complexed with cdl, chd, cmo, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 3ag1 (more details), 2.2 Å
SCOPe Domain Sequences for d3ag1d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ag1d_ f.23.1.1 (D:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
ldmkvapiqgfsakwdydknewkk
Timeline for d3ag1d_:
View in 3DDomains from other chains: (mouse over for more information) d3ag1a_, d3ag1b1, d3ag1b2, d3ag1c_, d3ag1e_, d3ag1f_, d3ag1g_, d3ag1h_, d3ag1i_, d3ag1j_, d3ag1k_, d3ag1l_, d3ag1m_, d3ag1n_, d3ag1o1, d3ag1o2, d3ag1p_, d3ag1q_, d3ag1r_, d3ag1s_, d3ag1t_, d3ag1u_, d3ag1v_, d3ag1w_, d3ag1x_, d3ag1y_, d3ag1z_ |