Lineage for d3ag1a_ (3ag1 A:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2255095Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
    12 transmembrane helices in an approximate threefold rotational symmetric arrangement
  4. 2255096Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) (S)
  5. 2255097Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
    the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3
  6. 2255189Protein automated matches [190134] (3 species)
    not a true protein
  7. 2255190Species Cow (Bos taurus) [TaxId:9913] [187061] (18 PDB entries)
  8. 2255209Domain d3ag1a_: 3ag1 A: [172044]
    Other proteins in same PDB: d3ag1b1, d3ag1b2, d3ag1c_, d3ag1d_, d3ag1e_, d3ag1f_, d3ag1g_, d3ag1h_, d3ag1i_, d3ag1j_, d3ag1k_, d3ag1l_, d3ag1m_, d3ag1o1, d3ag1o2, d3ag1p_, d3ag1q_, d3ag1r_, d3ag1s_, d3ag1t_, d3ag1u_, d3ag1v_, d3ag1w_, d3ag1x_, d3ag1y_, d3ag1z_
    automated match to d1occa_
    complexed with cdl, chd, cmo, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d3ag1a_

PDB Entry: 3ag1 (more details), 2.2 Å

PDB Description: Bovine Heart Cytochrome c Oxidase in the Carbon Monoxide-bound Fully Reduced State at 280 K
PDB Compounds: (A:) Cytochrome c oxidase subunit 1

SCOPe Domain Sequences for d3ag1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ag1a_ f.24.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta
hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea
gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq
tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh
pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd
trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan
ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg
vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr
evltvdltttnlewlngcpppyhtfeeptyvnlk

SCOPe Domain Coordinates for d3ag1a_:

Click to download the PDB-style file with coordinates for d3ag1a_.
(The format of our PDB-style files is described here.)

Timeline for d3ag1a_: