Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (130 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [187746] (21 PDB entries) |
Domain d3af3a_: 3af3 A: [172029] automated match to d1esma_ complexed with gcp, gol, pau |
PDB Entry: 3af3 (more details), 2.35 Å
SCOPe Domain Sequences for d3af3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3af3a_ c.37.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} epspyvefdrrqwralrmstplalteeelvglrglgeqidlleveevylplarlihlqva arqrlfaataeflgepqqnpdrpvpfiigvagsvavgksttarvlqallarwdhhprvdl vttdgflypnaelqrrnlmhrkgfpesynrralmrfvtsvksgsdyacapvyshlhydii pgaeqvvrhpdilileglnvlqtgptlmvsdlfdfslyvdariedieqwyvsrflamrtt afadpeshfhhyaafsdsqavvaareiwrtinrpnlvenilptrpratlvlrkdadhsin rlrlrkl
Timeline for d3af3a_: