SCOPe 2.01: Domain d3abmw_: 3abm W:

Lineage for d3abmw_ (3abm W:)

1. Root: SCOPe 2.01

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
   not a true fold

4. Superfamily f.23.4: Mitochondrial cytochrome c oxidase subunit VIIa [81419] (1 family)

5. Family f.23.4.1: Mitochondrial cytochrome c oxidase subunit VIIa [81418] (1 protein)

6. Protein Mitochondrial cytochrome c oxidase subunit VIIa [81417] (1 species)
   function unknown, probably acts as a regulator or is required for the assembly

7. Species Cow (Bos taurus) [TaxId:9913] [81416] (22 PDB entries)

8. Domain d3abmw_: 3abm W: [171990]
   Other proteins in same PDB: d3abma_, d3abmc_, d3abmd_, d3abme_, d3abmf_, d3abmg_, d3abmh_, d3abmi_, d3abmk_, d3abml_, d3abmm_, d3abmn_, d3abmp_, d3abmq_, d3abmr_, d3abms_, d3abmt_, d3abmu_, d3abmv_, d3abmx_, d3abmy_, d3abmz_
   automated match to d1ocrj_
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn

Details for d3abmw_

PDB Entry: 3abm, 1.95 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully oxidized state (200-s X-ray exposure dataset)

PDB Compounds: (W:) Cytochrome c oxidase polypeptide 7A1

SCOPe Domain Sequences for d3abmw_:

Sequence; same for both SEQRES and ATOM records:

>d3abmw_ f.23.4.1 (W:) Mitochondrial cytochrome c oxidase subunit VIIa {Cow (Bos taurus) [TaxId: 9913]}
fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfph

Timeline for d3abmw_:

• d3abmw_ is new in SCOPe 2.01-stable
  
• d3abmw_ appears in SCOPe 2.02
  
• d3abmw_ appears in the current release, SCOPe 2.08