Class a: All alpha proteins [46456] (284 folds) |
Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily) 4 helices; irregular array, disulfide-linked |
Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (1 family) |
Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins) |
Protein automated matches [190271] (1 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [187063] (16 PDB entries) |
Domain d3abmu_: 3abm U: [171988] Other proteins in same PDB: d3abma_, d3abmc_, d3abmd_, d3abme_, d3abmf_, d3abmg_, d3abmi_, d3abmj_, d3abmk_, d3abml_, d3abmm_, d3abmn_, d3abmp_, d3abmq_, d3abmr_, d3abms_, d3abmt_, d3abmv_, d3abmw_, d3abmx_, d3abmy_, d3abmz_ automated match to d1ocrh_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn |
PDB Entry: 3abm (more details), 1.95 Å
SCOPe Domain Sequences for d3abmu_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3abmu_ a.51.1.1 (U:) automated matches {Cow (Bos taurus) [TaxId: 9913]} yqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpiswvs twddrraegtfpgki
Timeline for d3abmu_: