Lineage for d3abmt_ (3abm T:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3024907Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family) (S)
    automatically mapped to Pfam PF02046
  5. 3024908Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (2 proteins)
  6. 3024909Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species)
    probably responsible for the dimerization of the mitochondrial cytochrome c oxidase
  7. 3024910Species Cow (Bos taurus) [TaxId:9913] [81408] (56 PDB entries)
  8. 3024922Domain d3abmt_: 3abm T: [171987]
    Other proteins in same PDB: d3abma_, d3abmb1, d3abmb2, d3abmc_, d3abmd_, d3abme_, d3abmf_, d3abmh_, d3abmi_, d3abmj_, d3abmk_, d3abml_, d3abmm_, d3abmn_, d3abmo1, d3abmo2, d3abmp_, d3abmq_, d3abmr_, d3abms_, d3abmu_, d3abmv_, d3abmw_, d3abmx_, d3abmy_, d3abmz_
    automated match to d1occg_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn

Details for d3abmt_

PDB Entry: 3abm (more details), 1.95 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully oxidized state (200-s X-ray exposure dataset)
PDB Compounds: (T:) Cytochrome c oxidase subunit 6A2

SCOPe Domain Sequences for d3abmt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3abmt_ f.23.2.1 (T:) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]}
asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
swgdgnhtffhnprvnplptgyek

SCOPe Domain Coordinates for d3abmt_:

Click to download the PDB-style file with coordinates for d3abmt_.
(The format of our PDB-style files is described here.)

Timeline for d3abmt_: