Lineage for d3abmr_ (3abm R:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1278585Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1279679Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (1 family) (S)
    automatically mapped to Pfam PF02284
  5. 1279680Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (1 protein)
  6. 1279681Protein Cytochrome c oxidase subunit E [48481] (1 species)
  7. 1279682Species Cow (Bos taurus) [TaxId:9913] [48482] (23 PDB entries)
  8. 1279692Domain d3abmr_: 3abm R: [171985]
    Other proteins in same PDB: d3abma_, d3abmb1, d3abmb2, d3abmc_, d3abmd_, d3abmf_, d3abmg_, d3abmh_, d3abmi_, d3abmj_, d3abmk_, d3abml_, d3abmm_, d3abmn_, d3abmo1, d3abmo2, d3abmp_, d3abmq_, d3abms_, d3abmt_, d3abmu_, d3abmv_, d3abmw_, d3abmx_, d3abmy_, d3abmz_
    automated match to d1occe_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn

Details for d3abmr_

PDB Entry: 3abm (more details), 1.95 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully oxidized state (200-s X-ray exposure dataset)
PDB Compounds: (R:) Cytochrome c oxidase subunit 5A

SCOPe Domain Sequences for d3abmr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3abmr_ a.118.11.1 (R:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]}
etdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasav
rilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

SCOPe Domain Coordinates for d3abmr_:

Click to download the PDB-style file with coordinates for d3abmr_.
(The format of our PDB-style files is described here.)

Timeline for d3abmr_: