Class a: All alpha proteins [46456] (290 folds) |
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (2 families) automatically mapped to Pfam PF02284 |
Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (2 proteins) |
Protein Cytochrome c oxidase subunit E [48481] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [48482] (50 PDB entries) |
Domain d3abmr_: 3abm R: [171985] Other proteins in same PDB: d3abma_, d3abmb1, d3abmb2, d3abmc_, d3abmd_, d3abmf_, d3abmg_, d3abmh_, d3abmi_, d3abmj_, d3abmk_, d3abml_, d3abmm_, d3abmn_, d3abmo1, d3abmo2, d3abmp_, d3abmq_, d3abms_, d3abmt_, d3abmu_, d3abmv_, d3abmw_, d3abmx_, d3abmy_, d3abmz_ automated match to d1occe_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn |
PDB Entry: 3abm (more details), 1.95 Å
SCOPe Domain Sequences for d3abmr_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3abmr_ a.118.11.1 (R:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} etdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasav rilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
Timeline for d3abmr_:
View in 3D Domains from other chains: (mouse over for more information) d3abma_, d3abmb1, d3abmb2, d3abmc_, d3abmd_, d3abme_, d3abmf_, d3abmg_, d3abmh_, d3abmi_, d3abmj_, d3abmk_, d3abml_, d3abmm_, d3abmn_, d3abmo1, d3abmo2, d3abmp_, d3abmq_, d3abms_, d3abmt_, d3abmu_, d3abmv_, d3abmw_, d3abmx_, d3abmy_, d3abmz_ |