Lineage for d3abmk_ (3abm K:)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1237971Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1238177Superfamily f.23.5: Mitochondrial cytochrome c oxidase subunit VIIb [81423] (1 family) (S)
  5. 1238178Family f.23.5.1: Mitochondrial cytochrome c oxidase subunit VIIb [81422] (2 proteins)
  6. 1238195Protein automated matches [190272] (1 species)
    not a true protein
  7. 1238196Species Cow (Bos taurus) [TaxId:9913] [187064] (16 PDB entries)
  8. 1238203Domain d3abmk_: 3abm K: [171979]
    Other proteins in same PDB: d3abma_, d3abmc_, d3abmd_, d3abme_, d3abmf_, d3abmg_, d3abmh_, d3abmi_, d3abmj_, d3abml_, d3abmm_, d3abmn_, d3abmp_, d3abmq_, d3abmr_, d3abms_, d3abmt_, d3abmu_, d3abmv_, d3abmw_, d3abmy_, d3abmz_
    automated match to d1occk_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn

Details for d3abmk_

PDB Entry: 3abm (more details), 1.95 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully oxidized state (200-s X-ray exposure dataset)
PDB Compounds: (K:) Cytochrome c oxidase subunit 7B

SCOPe Domain Sequences for d3abmk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3abmk_ f.23.5.1 (K:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr

SCOPe Domain Coordinates for d3abmk_:

Click to download the PDB-style file with coordinates for d3abmk_.
(The format of our PDB-style files is described here.)

Timeline for d3abmk_: