SCOPe 2.03: Domain d3abmg_: 3abm G:

Lineage for d3abmg_ (3abm G:)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
   not a true fold

4. Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family)
   automatically mapped to Pfam PF02046

5. Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (2 proteins)

6. Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species)
   probably responsible for the dimerization of the mitochondrial cytochrome c oxidase

7. Species Cow (Bos taurus) [TaxId:9913] [81408] (23 PDB entries)

8. Domain d3abmg_: 3abm G: [171975]
   Other proteins in same PDB: d3abma_, d3abmb1, d3abmb2, d3abmc_, d3abmd_, d3abme_, d3abmf_, d3abmh_, d3abmi_, d3abmj_, d3abmk_, d3abml_, d3abmm_, d3abmn_, d3abmo1, d3abmo2, d3abmp_, d3abmq_, d3abmr_, d3abms_, d3abmu_, d3abmv_, d3abmw_, d3abmx_, d3abmy_, d3abmz_
   automated match to d1occg_
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn

Details for d3abmg_

PDB Entry: 3abm, 1.95 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully oxidized state (200-s X-ray exposure dataset)

PDB Compounds: (G:) Cytochrome c oxidase subunit 6A2

SCOPe Domain Sequences for d3abmg_:

Sequence; same for both SEQRES and ATOM records:

>d3abmg_ f.23.2.1 (G:) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]}
asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
swgdgnhtffhnprvnplptgyek

Timeline for d3abmg_:

• d3abmg_ first appeared in SCOPe 2.01
  
• d3abmg_ appears in SCOPe 2.02
  
• d3abmg_ appears in SCOPe 2.04
  
• d3abmg_ appears in the current release, SCOPe 2.08