Lineage for d3abmg_ (3abm G:)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1456646Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1456701Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family) (S)
    automatically mapped to Pfam PF02046
  5. 1456702Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (2 proteins)
  6. 1456703Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species)
    probably responsible for the dimerization of the mitochondrial cytochrome c oxidase
  7. 1456704Species Cow (Bos taurus) [TaxId:9913] [81408] (23 PDB entries)
  8. 1456713Domain d3abmg_: 3abm G: [171975]
    Other proteins in same PDB: d3abma_, d3abmb1, d3abmb2, d3abmc_, d3abmd_, d3abme_, d3abmf_, d3abmh_, d3abmi_, d3abmj_, d3abmk_, d3abml_, d3abmm_, d3abmn_, d3abmo1, d3abmo2, d3abmp_, d3abmq_, d3abmr_, d3abms_, d3abmu_, d3abmv_, d3abmw_, d3abmx_, d3abmy_, d3abmz_
    automated match to d1occg_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn

Details for d3abmg_

PDB Entry: 3abm (more details), 1.95 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully oxidized state (200-s X-ray exposure dataset)
PDB Compounds: (G:) Cytochrome c oxidase subunit 6A2

SCOPe Domain Sequences for d3abmg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3abmg_ f.23.2.1 (G:) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]}
asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
swgdgnhtffhnprvnplptgyek

SCOPe Domain Coordinates for d3abmg_:

Click to download the PDB-style file with coordinates for d3abmg_.
(The format of our PDB-style files is described here.)

Timeline for d3abmg_: