Lineage for d3abmf_ (3abm F:)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1464002Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1464186Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 1464349Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (1 protein)
    membrane-anchored rubredoxin-like domain
    automatically mapped to Pfam PF01215
  6. 1464350Protein Cytochrome c oxidase Subunit F [57819] (1 species)
  7. 1464351Species Cow (Bos taurus) [TaxId:9913] [57820] (23 PDB entries)
  8. 1464360Domain d3abmf_: 3abm F: [171974]
    Other proteins in same PDB: d3abma_, d3abmb1, d3abmb2, d3abmc_, d3abmd_, d3abme_, d3abmg_, d3abmh_, d3abmi_, d3abmj_, d3abmk_, d3abml_, d3abmm_, d3abmn_, d3abmo1, d3abmo2, d3abmp_, d3abmq_, d3abmr_, d3abmt_, d3abmu_, d3abmv_, d3abmw_, d3abmx_, d3abmy_, d3abmz_
    automated match to d1occf_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn

Details for d3abmf_

PDB Entry: 3abm (more details), 1.95 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully oxidized state (200-s X-ray exposure dataset)
PDB Compounds: (F:) Cytochrome c oxidase subunit 5B

SCOPe Domain Sequences for d3abmf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3abmf_ g.41.5.3 (F:) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]}
ggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgcice
ednstviwfwlhkgeaqrcpscgthyklvphql

SCOPe Domain Coordinates for d3abmf_:

Click to download the PDB-style file with coordinates for d3abmf_.
(The format of our PDB-style files is described here.)

Timeline for d3abmf_: