![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily) core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest |
![]() | Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (1 family) ![]() |
![]() | Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins) function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel |
![]() | Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81444] (24 PDB entries) |
![]() | Domain d3abmc_: 3abm C: [171971] Other proteins in same PDB: d3abma_, d3abmd_, d3abme_, d3abmf_, d3abmg_, d3abmh_, d3abmi_, d3abmj_, d3abmk_, d3abml_, d3abmm_, d3abmn_, d3abmq_, d3abmr_, d3abms_, d3abmt_, d3abmu_, d3abmv_, d3abmw_, d3abmx_, d3abmy_, d3abmz_ automated match to d1occc_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn |
PDB Entry: 3abm (more details), 1.95 Å
SCOPe Domain Sequences for d3abmc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3abmc_ f.25.1.1 (C:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]} hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw hfvdvvwlflyvsiywwgs
Timeline for d3abmc_: