Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily) 12 transmembrane helices in an approximate threefold rotational symmetric arrangement |
Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) |
Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins) the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3 |
Protein automated matches [190134] (3 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [187061] (17 PDB entries) |
Domain d3abma_: 3abm A: [171970] Other proteins in same PDB: d3abmb1, d3abmb2, d3abmc_, d3abmd_, d3abme_, d3abmf_, d3abmg_, d3abmh_, d3abmi_, d3abmj_, d3abmk_, d3abml_, d3abmm_, d3abmo1, d3abmo2, d3abmp_, d3abmq_, d3abmr_, d3abms_, d3abmt_, d3abmu_, d3abmv_, d3abmw_, d3abmx_, d3abmy_, d3abmz_ automated match to d1occa_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn |
PDB Entry: 3abm (more details), 1.95 Å
SCOPe Domain Sequences for d3abma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3abma_ f.24.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]} mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr evltvdltttnlewlngcpppyhtfeeptyvnlk
Timeline for d3abma_:
View in 3D Domains from other chains: (mouse over for more information) d3abmb1, d3abmb2, d3abmc_, d3abmd_, d3abme_, d3abmf_, d3abmg_, d3abmh_, d3abmi_, d3abmj_, d3abmk_, d3abml_, d3abmm_, d3abmn_, d3abmo1, d3abmo2, d3abmp_, d3abmq_, d3abmr_, d3abms_, d3abmt_, d3abmu_, d3abmv_, d3abmw_, d3abmx_, d3abmy_, d3abmz_ |