| Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.7: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81431] (1 family) ![]() automatically mapped to Pfam PF02285 |
| Family f.23.7.1: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81430] (2 proteins) |
| Protein automated matches [190273] (1 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [187065] (19 PDB entries) |
| Domain d3ablz_: 3abl Z: [171969] Other proteins in same PDB: d3abla_, d3ablb1, d3ablb2, d3ablc_, d3abld_, d3able_, d3ablf_, d3ablg_, d3ablh_, d3abli_, d3ablj_, d3ablk_, d3abll_, d3abln_, d3ablo1, d3ablo2, d3ablp_, d3ablq_, d3ablr_, d3abls_, d3ablt_, d3ablu_, d3ablv_, d3ablw_, d3ablx_, d3ably_ automated match to d1occm_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn |
PDB Entry: 3abl (more details), 2.1 Å
SCOPe Domain Sequences for d3ablz_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ablz_ f.23.7.1 (Z:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks
Timeline for d3ablz_:
View in 3DDomains from other chains: (mouse over for more information) d3abla_, d3ablb1, d3ablb2, d3ablc_, d3abld_, d3able_, d3ablf_, d3ablg_, d3ablh_, d3abli_, d3ablj_, d3ablk_, d3abll_, d3ablm_, d3abln_, d3ablo1, d3ablo2, d3ablp_, d3ablq_, d3ablr_, d3abls_, d3ablt_, d3ablu_, d3ablv_, d3ablw_, d3ablx_, d3ably_ |