Lineage for d3abls_ (3abl S:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1065992Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1066160Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 1066318Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (1 protein)
    membrane-anchored rubredoxin-like domain
  6. 1066319Protein Cytochrome c oxidase Subunit F [57819] (1 species)
  7. 1066320Species Cow (Bos taurus) [TaxId:9913] [57820] (22 PDB entries)
  8. 1066340Domain d3abls_: 3abl S: [171962]
    Other proteins in same PDB: d3abla_, d3ablc_, d3abld_, d3able_, d3ablg_, d3ablh_, d3abli_, d3ablj_, d3ablk_, d3abll_, d3ablm_, d3abln_, d3ablp_, d3ablq_, d3ablr_, d3ablt_, d3ablu_, d3ablv_, d3ablw_, d3ablx_, d3ably_, d3ablz_
    automated match to d1occf_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn

Details for d3abls_

PDB Entry: 3abl (more details), 2.1 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully oxidized state (15-s X-ray exposure dataset)
PDB Compounds: (S:) Cytochrome c oxidase subunit 5B

SCOPe Domain Sequences for d3abls_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3abls_ g.41.5.3 (S:) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]}
ggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgcice
ednstviwfwlhkgeaqrcpscgthyklvphql

SCOPe Domain Coordinates for d3abls_:

Click to download the PDB-style file with coordinates for d3abls_.
(The format of our PDB-style files is described here.)

Timeline for d3abls_: