Lineage for d1omd__ (1omd -)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 537532Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 537533Superfamily a.39.1: EF-hand [47473] (10 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 537668Family a.39.1.4: Parvalbumin [47492] (2 proteins)
    6-helices; array of 3 hairpins, closed
    made with two-helical hairpin and two EF-hands
  6. 537669Protein Oncomodulin [47493] (1 species)
  7. 537670Species Rat (Rattus norvegicus) [TaxId:10116] [47494] (2 PDB entries)
  8. 537672Domain d1omd__: 1omd - [17196]
    complexed with ca

Details for d1omd__

PDB Entry: 1omd (more details), 1.85 Å

PDB Description: structure of oncomodulin refined at 1.85 angstroms resolution. an example of extensive molecular aggregation via ca2+

SCOP Domain Sequences for d1omd__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1omd__ a.39.1.4 (-) Oncomodulin {Rat (Rattus norvegicus)}
itdilsaediaaalqecqdpdtfepqkffqtsglskmsasqvkdifrfidndqsgyldgd
elkyflqkfqsdareltesetkslmdaadndgdgkigadefqemvhs

SCOP Domain Coordinates for d1omd__:

Click to download the PDB-style file with coordinates for d1omd__.
(The format of our PDB-style files is described here.)

Timeline for d1omd__: