SCOP 1.59: Domain d1omd__: 1omd -

Lineage for d1omd__ (1omd -)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)

4. Superfamily a.39.1: EF-hand [47473] (8 families)

5. Family a.39.1.4: Parvalbumin [47492] (2 proteins)

6. Protein Oncomodulin [47493] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [47494] (2 PDB entries)

8. Domain d1omd__: 1omd - [17196]

Details for d1omd__

PDB Entry: 1omd, 1.85 Å

PDB Description: structure of oncomodulin refined at 1.85 angstroms resolution. an example of extensive molecular aggregation via ca2+

SCOP Domain Sequences for d1omd__:

Sequence; same for both SEQRES and ATOM records:

>d1omd__ a.39.1.4 (-) Oncomodulin {Rat (Rattus norvegicus)}
itdilsaediaaalqecqdpdtfepqkffqtsglskmsasqvkdifrfidndqsgyldgd
elkyflqkfqsdareltesetkslmdaadndgdgkigadefqemvhs

Timeline for d1omd__:

• d1omd__ first appeared (with stable ids) in SCOP 1.55
  
• d1omd__ appears in SCOP 1.57
  
• d1omd__ appears in SCOP 1.61
  
• d1omd__ appears in the current release, SCOPe 2.08, called d1omda_