Lineage for d1omd__ (1omd -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) Fold a.39: EF Hand-like [47472] (3 superfamilies) Superfamily a.39.1: EF-hand [47473] (7 families) 
Family a.39.1.4: Parvalbumin [47492] (2 proteins) 
Protein Oncomodulin [47493] (1 species) Species Rat (Rattus norvegicus) [TaxId:10116] [47494] (2 PDB entries) 
Domain d1omd__: 1omd - [17196]
Details for d1omd__
PDB Entry: 1omd (more details), 1.85 Å
PDB Description: structure of oncomodulin refined at 1.85 angstroms resolution. an example of extensive molecular aggregation via ca2+
SCOP Domain Sequences for d1omd__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1omd__ a.39.1.4 (-) Oncomodulin {Rat (Rattus norvegicus)}
itdilsaediaaalqecqdpdtfepqkffqtsglskmsasqvkdifrfidndqsgyldgd
elkyflqkfqsdareltesetkslmdaadndgdgkigadefqemvhs
SCOP Domain Coordinates for d1omd__:
Click to download the PDB-style file with coordinates for d1omd__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1omd__:
- d1omd__ appears in SCOP 1.57
- d1omd__ appears in the current release, SCOPe 2.08, called d1omda_
View in 3D