![]() | Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
![]() | Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily) core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest |
![]() | Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (1 family) ![]() automatically mapped to Pfam PF00510 |
![]() | Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins) function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel |
![]() | Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81444] (37 PDB entries) |
![]() | Domain d3ablp_: 3abl P: [171959] Other proteins in same PDB: d3abla_, d3ablb1, d3ablb2, d3abld_, d3able_, d3ablf_, d3ablg_, d3ablh_, d3abli_, d3ablj_, d3ablk_, d3abll_, d3ablm_, d3abln_, d3ablo1, d3ablo2, d3ablq_, d3ablr_, d3abls_, d3ablt_, d3ablu_, d3ablv_, d3ablw_, d3ablx_, d3ably_, d3ablz_ automated match to d1occc_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn |
PDB Entry: 3abl (more details), 2.1 Å
SCOPe Domain Sequences for d3ablp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ablp_ f.25.1.1 (P:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]} hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw hfvdvvwlflyvsiywwgs
Timeline for d3ablp_:
![]() Domains from other chains: (mouse over for more information) d3abla_, d3ablb1, d3ablb2, d3ablc_, d3abld_, d3able_, d3ablf_, d3ablg_, d3ablh_, d3abli_, d3ablj_, d3ablk_, d3abll_, d3ablm_, d3abln_, d3ablo1, d3ablo2, d3ablq_, d3ablr_, d3abls_, d3ablt_, d3ablu_, d3ablv_, d3ablw_, d3ablx_, d3ably_, d3ablz_ |