Lineage for d3abln_ (3abl N:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2632295Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
    12 transmembrane helices in an approximate threefold rotational symmetric arrangement
  4. 2632296Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) (S)
  5. 2632297Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
    the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3
  6. 2632417Protein automated matches [190134] (4 species)
    not a true protein
  7. 2632418Species Cow (Bos taurus) [TaxId:9913] [187061] (18 PDB entries)
  8. 2632434Domain d3abln_: 3abl N: [171958]
    Other proteins in same PDB: d3ablb1, d3ablb2, d3ablc_, d3abld_, d3able_, d3ablf_, d3ablg_, d3ablh_, d3abli_, d3ablj_, d3ablk_, d3abll_, d3ablm_, d3ablo1, d3ablo2, d3ablp_, d3ablq_, d3ablr_, d3abls_, d3ablt_, d3ablu_, d3ablv_, d3ablw_, d3ablx_, d3ably_, d3ablz_
    automated match to d1occa_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn

Details for d3abln_

PDB Entry: 3abl (more details), 2.1 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully oxidized state (15-s X-ray exposure dataset)
PDB Compounds: (N:) Cytochrome c oxidase subunit 1

SCOPe Domain Sequences for d3abln_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3abln_ f.24.1.1 (N:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta
hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea
gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq
tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh
pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd
trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan
ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg
vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr
evltvdltttnlewlngcpppyhtfeeptyvnlk

SCOPe Domain Coordinates for d3abln_:

Click to download the PDB-style file with coordinates for d3abln_.
(The format of our PDB-style files is described here.)

Timeline for d3abln_: