SCOPe 2.05: Domain d3ablm_: 3abl M:

Lineage for d3ablm_ (3abl M:)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (40 superfamilies)
   not a true fold

4. Superfamily f.23.7: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81431] (1 family)
   automatically mapped to Pfam PF02285

5. Family f.23.7.1: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81430] (2 proteins)

6. Protein automated matches [190273] (1 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [187065] (18 PDB entries)

8. Domain d3ablm_: 3abl M: [171957]
   Other proteins in same PDB: d3abla_, d3ablb1, d3ablb2, d3ablc_, d3abld_, d3able_, d3ablf_, d3ablg_, d3ablh_, d3abli_, d3ablj_, d3ablk_, d3abll_, d3abln_, d3ablo1, d3ablo2, d3ablp_, d3ablq_, d3ablr_, d3abls_, d3ablt_, d3ablu_, d3ablv_, d3ablw_, d3ablx_, d3ably_
   automated match to d1occm_
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn

Details for d3ablm_

PDB Entry: 3abl, 2.1 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully oxidized state (15-s X-ray exposure dataset)

PDB Compounds: (M:) Cytochrome c oxidase subunit 8B

SCOPe Domain Sequences for d3ablm_:

Sequence; same for both SEQRES and ATOM records:

>d3ablm_ f.23.7.1 (M:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks

Timeline for d3ablm_:

• d3ablm_ first appeared in SCOPe 2.01
  
• d3ablm_ appears in SCOPe 2.04
  
• d3ablm_ appears in SCOPe 2.06
  
• d3ablm_ appears in the current release, SCOPe 2.08