Lineage for d3ablm_ (3abl M:)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1237971Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1238281Superfamily f.23.7: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81431] (1 family) (S)
  5. 1238282Family f.23.7.1: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81430] (2 proteins)
  6. 1238299Protein automated matches [190273] (1 species)
    not a true protein
  7. 1238300Species Cow (Bos taurus) [TaxId:9913] [187065] (16 PDB entries)
  8. 1238315Domain d3ablm_: 3abl M: [171957]
    Other proteins in same PDB: d3abla_, d3ablc_, d3abld_, d3able_, d3ablf_, d3ablg_, d3ablh_, d3abli_, d3ablj_, d3ablk_, d3abll_, d3abln_, d3ablp_, d3ablq_, d3ablr_, d3abls_, d3ablt_, d3ablu_, d3ablv_, d3ablw_, d3ablx_, d3ably_
    automated match to d1occm_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn

Details for d3ablm_

PDB Entry: 3abl (more details), 2.1 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully oxidized state (15-s X-ray exposure dataset)
PDB Compounds: (M:) Cytochrome c oxidase subunit 8B

SCOPe Domain Sequences for d3ablm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ablm_ f.23.7.1 (M:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks

SCOPe Domain Coordinates for d3ablm_:

Click to download the PDB-style file with coordinates for d3ablm_.
(The format of our PDB-style files is described here.)

Timeline for d3ablm_: