Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.6: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81427] (1 family) automatically mapped to Pfam PF02935 |
Family f.23.6.1: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81426] (2 proteins) |
Protein Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81425] (1 species) function unknown, probably acts as a regulator or is required for the assembly |
Species Cow (Bos taurus) [TaxId:9913] [81424] (49 PDB entries) |
Domain d3abll_: 3abl L: [171956] Other proteins in same PDB: d3abla_, d3ablb1, d3ablb2, d3ablc_, d3abld_, d3able_, d3ablf_, d3ablg_, d3ablh_, d3abli_, d3ablj_, d3ablk_, d3ablm_, d3abln_, d3ablo1, d3ablo2, d3ablp_, d3ablq_, d3ablr_, d3abls_, d3ablt_, d3ablu_, d3ablv_, d3ablw_, d3ablx_, d3ablz_ automated match to d1occl_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn |
PDB Entry: 3abl (more details), 2.1 Å
SCOPe Domain Sequences for d3abll_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3abll_ f.23.6.1 (L:) Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) {Cow (Bos taurus) [TaxId: 9913]} hyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk
Timeline for d3abll_:
View in 3D Domains from other chains: (mouse over for more information) d3abla_, d3ablb1, d3ablb2, d3ablc_, d3abld_, d3able_, d3ablf_, d3ablg_, d3ablh_, d3abli_, d3ablj_, d3ablk_, d3ablm_, d3abln_, d3ablo1, d3ablo2, d3ablp_, d3ablq_, d3ablr_, d3abls_, d3ablt_, d3ablu_, d3ablv_, d3ablw_, d3ablx_, d3ably_, d3ablz_ |