Lineage for d3abli_ (3abl I:)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1059389Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1059492Superfamily f.23.3: Mitochondrial cytochrome c oxidase subunit VIc [81415] (1 family) (S)
  5. 1059493Family f.23.3.1: Mitochondrial cytochrome c oxidase subunit VIc [81414] (1 protein)
  6. 1059494Protein Mitochondrial cytochrome c oxidase subunit VIc [81413] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 1059495Species Cow (Bos taurus) [TaxId:9913] [81412] (23 PDB entries)
  8. 1059516Domain d3abli_: 3abl I: [171953]
    Other proteins in same PDB: d3abla_, d3ablc_, d3abld_, d3able_, d3ablf_, d3ablg_, d3ablh_, d3ablj_, d3ablk_, d3abll_, d3ablm_, d3abln_, d3ablp_, d3ablq_, d3ablr_, d3abls_, d3ablt_, d3ablu_, d3ablw_, d3ablx_, d3ably_, d3ablz_
    automated match to d1occi_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn

Details for d3abli_

PDB Entry: 3abl (more details), 2.1 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully oxidized state (15-s X-ray exposure dataset)
PDB Compounds: (I:) Cytochrome c oxidase subunit 6C

SCOPe Domain Sequences for d3abli_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3abli_ f.23.3.1 (I:) Mitochondrial cytochrome c oxidase subunit VIc {Cow (Bos taurus) [TaxId: 9913]}
alakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdfee
mrkagifqsak

SCOPe Domain Coordinates for d3abli_:

Click to download the PDB-style file with coordinates for d3abli_.
(The format of our PDB-style files is described here.)

Timeline for d3abli_: