Lineage for d1rro__ (1rro -)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 97344Fold a.39: EF Hand-like [47472] (4 superfamilies)
  4. 97345Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 97432Family a.39.1.4: Parvalbumin [47492] (2 proteins)
  6. 97433Protein Oncomodulin [47493] (1 species)
  7. 97434Species Rat (Rattus norvegicus) [TaxId:10116] [47494] (2 PDB entries)
  8. 97435Domain d1rro__: 1rro - [17195]

Details for d1rro__

PDB Entry: 1rro (more details), 1.3 Å

PDB Description: refinement of recombinant oncomodulin at 1.30 angstroms resolution

SCOP Domain Sequences for d1rro__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rro__ a.39.1.4 (-) Oncomodulin {Rat (Rattus norvegicus)}
sitdilsaediaaalqecqdpdtfepqkffqtsglskmsasqvkdifrfidndqsgyldg
delkyflqkfqsdareltesetkslmdaadndgdgkigadefqemvhs

SCOP Domain Coordinates for d1rro__:

Click to download the PDB-style file with coordinates for d1rro__.
(The format of our PDB-style files is described here.)

Timeline for d1rro__: