Lineage for d3able_ (3abl E:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 921849Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 922772Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (1 family) (S)
  5. 922773Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (1 protein)
  6. 922774Protein Cytochrome c oxidase subunit E [48481] (1 species)
  7. 922775Species Cow (Bos taurus) [TaxId:9913] [48482] (22 PDB entries)
  8. 922794Domain d3able_: 3abl E: [171949]
    Other proteins in same PDB: d3abla_, d3ablc_, d3abld_, d3ablf_, d3ablg_, d3ablh_, d3abli_, d3ablj_, d3ablk_, d3abll_, d3ablm_, d3abln_, d3ablp_, d3ablq_, d3abls_, d3ablt_, d3ablu_, d3ablv_, d3ablw_, d3ablx_, d3ably_, d3ablz_
    automated match to d1occe_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn

Details for d3able_

PDB Entry: 3abl (more details), 2.1 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully oxidized state (15-s X-ray exposure dataset)
PDB Compounds: (E:) Cytochrome c oxidase subunit 5A

SCOPe Domain Sequences for d3able_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3able_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]}
etdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasav
rilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

SCOPe Domain Coordinates for d3able_:

Click to download the PDB-style file with coordinates for d3able_.
(The format of our PDB-style files is described here.)

Timeline for d3able_: