Lineage for d3abkx_ (3abk X:)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1059389Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1059590Superfamily f.23.5: Mitochondrial cytochrome c oxidase subunit VIIb [81423] (1 family) (S)
  5. 1059591Family f.23.5.1: Mitochondrial cytochrome c oxidase subunit VIIb [81422] (2 proteins)
  6. 1059608Protein automated matches [190272] (1 species)
    not a true protein
  7. 1059609Species Cow (Bos taurus) [TaxId:9913] [187064] (15 PDB entries)
  8. 1059621Domain d3abkx_: 3abk X: [171943]
    Other proteins in same PDB: d3abka_, d3abkc_, d3abkd_, d3abke_, d3abkf_, d3abkg_, d3abkh_, d3abki_, d3abkj_, d3abkl_, d3abkm_, d3abkn_, d3abkp_, d3abkq_, d3abkr_, d3abks_, d3abkt_, d3abku_, d3abkv_, d3abkw_, d3abky_, d3abkz_
    automated match to d1occk_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, no, pek, pgv, psc, tgl, unx, zn

Details for d3abkx_

PDB Entry: 3abk (more details), 2 Å

PDB Description: Bovine heart cytochrome c oxidase at the NO-bound fully reduced state (50K)
PDB Compounds: (X:) Cytochrome c oxidase subunit 7B

SCOPe Domain Sequences for d3abkx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3abkx_ f.23.5.1 (X:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr

SCOPe Domain Coordinates for d3abkx_:

Click to download the PDB-style file with coordinates for d3abkx_.
(The format of our PDB-style files is described here.)

Timeline for d3abkx_: