| Class a: All alpha proteins [46456] (285 folds) |
| Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily) 4 helices; irregular array, disulfide-linked |
Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (1 family) ![]() |
| Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins) |
| Protein automated matches [190271] (1 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [187063] (18 PDB entries) |
| Domain d3abku_: 3abk U: [171940] Other proteins in same PDB: d3abka_, d3abkb1, d3abkb2, d3abkc_, d3abkd_, d3abke_, d3abkf_, d3abkg_, d3abki_, d3abkj_, d3abkk_, d3abkl_, d3abkm_, d3abkn_, d3abko1, d3abko2, d3abkp_, d3abkq_, d3abkr_, d3abks_, d3abkt_, d3abkv_, d3abkw_, d3abkx_, d3abky_, d3abkz_ automated match to d1ocrh_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, no, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 3abk (more details), 2 Å
SCOPe Domain Sequences for d3abku_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3abku_ a.51.1.1 (U:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki
Timeline for d3abku_:
View in 3DDomains from other chains: (mouse over for more information) d3abka_, d3abkb1, d3abkb2, d3abkc_, d3abkd_, d3abke_, d3abkf_, d3abkg_, d3abkh_, d3abki_, d3abkj_, d3abkk_, d3abkl_, d3abkm_, d3abkn_, d3abko1, d3abko2, d3abkp_, d3abkq_, d3abkr_, d3abks_, d3abkt_, d3abkv_, d3abkw_, d3abkx_, d3abky_, d3abkz_ |