Lineage for d3abkt_ (3abk T:)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1059389Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1059440Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family) (S)
  5. 1059441Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (2 proteins)
  6. 1059442Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species)
    probably responsible for the dimerization of the mitochondrial cytochrome c oxidase
  7. 1059443Species Cow (Bos taurus) [TaxId:9913] [81408] (22 PDB entries)
  8. 1059459Domain d3abkt_: 3abk T: [171939]
    Other proteins in same PDB: d3abka_, d3abkc_, d3abkd_, d3abke_, d3abkf_, d3abkh_, d3abki_, d3abkj_, d3abkk_, d3abkl_, d3abkm_, d3abkn_, d3abkp_, d3abkq_, d3abkr_, d3abks_, d3abku_, d3abkv_, d3abkw_, d3abkx_, d3abky_, d3abkz_
    automated match to d1occg_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, no, pek, pgv, psc, tgl, unx, zn

Details for d3abkt_

PDB Entry: 3abk (more details), 2 Å

PDB Description: Bovine heart cytochrome c oxidase at the NO-bound fully reduced state (50K)
PDB Compounds: (T:) Cytochrome c oxidase subunit 6A2

SCOPe Domain Sequences for d3abkt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3abkt_ f.23.2.1 (T:) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]}
asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
swgdgnhtffhnprvnplptgyek

SCOPe Domain Coordinates for d3abkt_:

Click to download the PDB-style file with coordinates for d3abkt_.
(The format of our PDB-style files is described here.)

Timeline for d3abkt_: