![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (1 family) ![]() automatically mapped to Pfam PF02284 |
![]() | Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (2 proteins) |
![]() | Protein Cytochrome c oxidase subunit E [48481] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [48482] (25 PDB entries) |
![]() | Domain d3abkr_: 3abk R: [171937] Other proteins in same PDB: d3abka_, d3abkb1, d3abkb2, d3abkc_, d3abkd_, d3abkf_, d3abkg_, d3abkh_, d3abki_, d3abkj_, d3abkk_, d3abkl_, d3abkm_, d3abkn_, d3abko1, d3abko2, d3abkp_, d3abkq_, d3abks_, d3abkt_, d3abku_, d3abkv_, d3abkw_, d3abkx_, d3abky_, d3abkz_ automated match to d1occe_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, no, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 3abk (more details), 2 Å
SCOPe Domain Sequences for d3abkr_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3abkr_ a.118.11.1 (R:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
Timeline for d3abkr_:
![]() Domains from other chains: (mouse over for more information) d3abka_, d3abkb1, d3abkb2, d3abkc_, d3abkd_, d3abke_, d3abkf_, d3abkg_, d3abkh_, d3abki_, d3abkj_, d3abkk_, d3abkl_, d3abkm_, d3abkn_, d3abko1, d3abko2, d3abkp_, d3abkq_, d3abks_, d3abkt_, d3abku_, d3abkv_, d3abkw_, d3abkx_, d3abky_, d3abkz_ |