![]() | Class a: All alpha proteins [46456] (144 folds) |
![]() | Fold a.39: EF Hand-like [47472] (3 superfamilies) |
![]() | Superfamily a.39.1: EF-hand [47473] (8 families) ![]() |
![]() | Family a.39.1.3: Osteonectin [47489] (1 protein) |
![]() | Protein C-terminal (EC) domain of BM-40/SPARC/osteonectin [47490] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47491] (3 PDB entries) |
![]() | Domain d1bmoa1: 1bmo A:136-286 [17193] Other proteins in same PDB: d1bmoa2, d1bmoa3, d1bmob2, d1bmob3 |
PDB Entry: 1bmo (more details), 3.1 Å
SCOP Domain Sequences for d1bmoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bmoa1 a.39.1.3 (A:136-286) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens)} ppcldseltefplrmrdwlknvlvtlyerdednnlltekqklrvkkihenekrleagdhp vellardfeknynmyifpvhwqfgqldqhpidgylshtelaplraplipmehcttrffet cdldndkyialdewagcfgikqkdidkdlvi
Timeline for d1bmoa1: