Lineage for d1bmoa1 (1bmo A:136-286)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 47511Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 47512Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 47576Family a.39.1.3: Osteonectin [47489] (1 protein)
  6. 47577Protein C-terminal (EC) domain of BM-40/SPARC/osteonectin [47490] (1 species)
  7. 47578Species Human (Homo sapiens) [TaxId:9606] [47491] (3 PDB entries)
  8. 47582Domain d1bmoa1: 1bmo A:136-286 [17193]
    Other proteins in same PDB: d1bmoa2, d1bmoa3, d1bmob2, d1bmob3

Details for d1bmoa1

PDB Entry: 1bmo (more details), 3.1 Å

PDB Description: bm-40, fs/ec domain pair

SCOP Domain Sequences for d1bmoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bmoa1 a.39.1.3 (A:136-286) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens)}
ppcldseltefplrmrdwlknvlvtlyerdednnlltekqklrvkkihenekrleagdhp
vellardfeknynmyifpvhwqfgqldqhpidgylshtelaplraplipmehcttrffet
cdldndkyialdewagcfgikqkdidkdlvi

SCOP Domain Coordinates for d1bmoa1:

Click to download the PDB-style file with coordinates for d1bmoa1.
(The format of our PDB-style files is described here.)

Timeline for d1bmoa1: