Class a: All alpha proteins [46456] (284 folds) |
Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (1 family) |
Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (1 protein) |
Protein Cytochrome c oxidase subunit E [48481] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [48482] (22 PDB entries) |
Domain d3abke_: 3abk E: [171925] Other proteins in same PDB: d3abka_, d3abkc_, d3abkd_, d3abkf_, d3abkg_, d3abkh_, d3abki_, d3abkj_, d3abkk_, d3abkl_, d3abkm_, d3abkn_, d3abkp_, d3abkq_, d3abks_, d3abkt_, d3abku_, d3abkv_, d3abkw_, d3abkx_, d3abky_, d3abkz_ automated match to d1occe_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, no, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 3abk (more details), 2 Å
SCOPe Domain Sequences for d3abke_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3abke_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
Timeline for d3abke_: