Lineage for d3abke_ (3abk E:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 921849Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 922772Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (1 family) (S)
  5. 922773Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (1 protein)
  6. 922774Protein Cytochrome c oxidase subunit E [48481] (1 species)
  7. 922775Species Cow (Bos taurus) [TaxId:9913] [48482] (22 PDB entries)
  8. 922790Domain d3abke_: 3abk E: [171925]
    Other proteins in same PDB: d3abka_, d3abkc_, d3abkd_, d3abkf_, d3abkg_, d3abkh_, d3abki_, d3abkj_, d3abkk_, d3abkl_, d3abkm_, d3abkn_, d3abkp_, d3abkq_, d3abks_, d3abkt_, d3abku_, d3abkv_, d3abkw_, d3abkx_, d3abky_, d3abkz_
    automated match to d1occe_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, no, pek, pgv, psc, tgl, unx, zn

Details for d3abke_

PDB Entry: 3abk (more details), 2 Å

PDB Description: Bovine heart cytochrome c oxidase at the NO-bound fully reduced state (50K)
PDB Compounds: (E:) Cytochrome c oxidase subunit 5A

SCOPe Domain Sequences for d3abke_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3abke_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]}
hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

SCOPe Domain Coordinates for d3abke_:

Click to download the PDB-style file with coordinates for d3abke_.
(The format of our PDB-style files is described here.)

Timeline for d3abke_: