Lineage for d3abfa_ (3abf A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2960762Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 2960763Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) (S)
  5. 2961445Family d.80.1.0: automated matches [191533] (1 protein)
    not a true family
  6. 2961446Protein automated matches [190903] (22 species)
    not a true protein
  7. 2961600Species Thermus thermophilus HB8 [TaxId:300852] [189563] (1 PDB entry)
  8. 2961601Domain d3abfa_: 3abf A: [171916]
    automated match to d1bjpa_
    complexed with so4

Details for d3abfa_

PDB Entry: 3abf (more details), 1.94 Å

PDB Description: crystal structure of a 4-oxalocrotonate tautomerase homologue (tthb242)
PDB Compounds: (A:) 4-oxalocrotonate tautomerase

SCOPe Domain Sequences for d3abfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3abfa_ d.80.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mvvlkvtllegrppekkrelvrrltemasrllgepyeevrvilyevrrdqwaaggvlfsd
kegt

SCOPe Domain Coordinates for d3abfa_:

Click to download the PDB-style file with coordinates for d3abfa_.
(The format of our PDB-style files is described here.)

Timeline for d3abfa_: