Lineage for d1nuba1 (1nub A:136-286)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3180Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 3181Superfamily a.39.1: EF-hand [47473] (7 families) (S)
  5. 3243Family a.39.1.3: Osteonectin [47489] (1 protein)
  6. 3244Protein C-terminal (EC) domain of BM-40/SPARC/osteonectin [47490] (1 species)
  7. 3245Species Human (Homo sapiens) [TaxId:9606] [47491] (3 PDB entries)
  8. 3247Domain d1nuba1: 1nub A:136-286 [17191]
    Other proteins in same PDB: d1nuba2, d1nuba3, d1nubb2, d1nubb3

Details for d1nuba1

PDB Entry: 1nub (more details), 2.8 Å

PDB Description: helix c deletion mutant of bm-40 fs-ec domain pair

SCOP Domain Sequences for d1nuba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nuba1 a.39.1.3 (A:136-286) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens)}
ppcldseltefplrmrdwlknvlvtlyerdednnlltekqklrvkkihenekrleagdhp
eknynmyifpvhwqfgqldqhpidgylshtelaplraplipmehcttrffetcdldndky
ialdewagcfgikqkdidkdlvi

SCOP Domain Coordinates for d1nuba1:

Click to download the PDB-style file with coordinates for d1nuba1.
(The format of our PDB-style files is described here.)

Timeline for d1nuba1: