![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein Ubiquitin [54238] (9 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [190020] (9 PDB entries) |
![]() | Domain d3a9jb_: 3a9j B: [171887] automated match to d1aara_ complexed with zn |
PDB Entry: 3a9j (more details), 1.18 Å
SCOPe Domain Sequences for d3a9jb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a9jb_ d.15.1.1 (B:) Ubiquitin {Mouse (Mus musculus) [TaxId: 10090]} mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn iqkestlhlvlrlrggd
Timeline for d3a9jb_: