Lineage for d3a8ob_ (3a8o B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1784139Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) (S)
  5. 1784177Family b.34.4.4: Nitrile hydratase beta chain [50101] (3 proteins)
    contains irregular array of helices in the N-terminal extension
    automatically mapped to Pfam PF02211
  6. 1784187Protein Iron-containing nitrile hydratase [50102] (1 species)
  7. 1784188Species Rhodococcus erythropolis [TaxId:1833] [50103] (24 PDB entries)
    also Rhodococcus sp. R312
  8. 1784205Domain d3a8ob_: 3a8o B: [171882]
    Other proteins in same PDB: d3a8oa_
    automated match to d1ahjb_
    complexed with fe, tay

Details for d3a8ob_

PDB Entry: 3a8o (more details), 1.47 Å

PDB Description: Crystal structure of Nitrile Hydratase complexed with Trimethylacetamide
PDB Compounds: (B:) Nitrile hydratase subunit beta

SCOPe Domain Sequences for d3a8ob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a8ob_ b.34.4.4 (B:) Iron-containing nitrile hydratase {Rhodococcus erythropolis [TaxId: 1833]}
mdgvhdlagvqgfgkvphtvnadigptfhaewehlpyslmfagvaelgafsvdevryvve
rmeprhymmtpyyeryvigvatlmvekgiltqdeleslaggpfplsrpsesegrpapvet
ttfevgqrvrvrdeyvpghirmpaycrgrvgtishrttekwpfpdaighgrndageepty
hvkfaaeelfgsdtdggsvvvdlfegylepaa

SCOPe Domain Coordinates for d3a8ob_:

Click to download the PDB-style file with coordinates for d3a8ob_.
(The format of our PDB-style files is described here.)

Timeline for d3a8ob_: