Lineage for d3a8la_ (3a8l A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2987858Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily)
    4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets
  4. 2987859Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (2 families) (S)
    duplication: contains two structural repeats
  5. 2987860Family d.149.1.1: Nitrile hydratase alpha chain [56210] (3 proteins)
    automatically mapped to Pfam PF02979
  6. 2987880Protein automated matches [190256] (6 species)
    not a true protein
  7. 2987913Species Rhodococcus erythropolis [TaxId:1833] [187042] (24 PDB entries)
  8. 2987934Domain d3a8la_: 3a8l A: [171877]
    Other proteins in same PDB: d3a8lb_
    automated match to d2ahja_
    complexed with fe; mutant

Details for d3a8la_

PDB Entry: 3a8l (more details), 1.63 Å

PDB Description: crystal structure of photo-activation state of nitrile hydratase mutant s113a
PDB Compounds: (A:) Nitrile hydratase subunit alpha

SCOPe Domain Sequences for d3a8la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a8la_ d.149.1.1 (A:) automated matches {Rhodococcus erythropolis [TaxId: 1833]}
enaapaqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvarawtdpe
frqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcactawpilglpptwyk
sfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqeqlqe
ivtkdcligvaipqvpt

SCOPe Domain Coordinates for d3a8la_:

Click to download the PDB-style file with coordinates for d3a8la_.
(The format of our PDB-style files is described here.)

Timeline for d3a8la_: