Lineage for d3a8ha_ (3a8h A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1934013Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily)
    4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets
  4. 1934014Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (2 families) (S)
    duplication: contains two structural repeats
  5. 1934015Family d.149.1.1: Nitrile hydratase alpha chain [56210] (3 proteins)
    automatically mapped to Pfam PF02979
  6. 1934035Protein automated matches [190256] (6 species)
    not a true protein
  7. 1934068Species Rhodococcus erythropolis [TaxId:1833] [187042] (20 PDB entries)
  8. 1934085Domain d3a8ha_: 3a8h A: [171869]
    Other proteins in same PDB: d3a8hb_
    automated match to d2ahja_
    complexed with fe, tay; mutant

Details for d3a8ha_

PDB Entry: 3a8h (more details), 1.66 Å

PDB Description: crystal structure of nitrile hydratase mutant s113a complexed with trimethylacetamide
PDB Compounds: (A:) Nitrile hydratase subunit alpha

SCOPe Domain Sequences for d3a8ha_:

Sequence, based on SEQRES records: (download)

>d3a8ha_ d.149.1.1 (A:) automated matches {Rhodococcus erythropolis [TaxId: 1833]}
tenaapaqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvarawtdp
efrqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcactawpilglpptwy
ksfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqeqlq
eivtkdcligvaipqvp

Sequence, based on observed residues (ATOM records): (download)

>d3a8ha_ d.149.1.1 (A:) automated matches {Rhodococcus erythropolis [TaxId: 1833]}
tenaapaqapvsdrawalfaldgkglvpdgyvegwktfeedfsprgaelvarawtdpfrl
lltdgtaavaqygylgpqgeyivavedtptlknvivcslcactawpilglpptwyksfey
rarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqqlqivtkdc
ligvaipqvp

SCOPe Domain Coordinates for d3a8ha_:

Click to download the PDB-style file with coordinates for d3a8ha_.
(The format of our PDB-style files is described here.)

Timeline for d3a8ha_: