SCOPe 2.06: Domain d3a6ob1: 3a6o B:1-120

Lineage for d3a6ob1 (3a6o B:1-120)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Maltogenic amylase, N-terminal domain N [49221] (4 species)
   precedes the catalytic (beta/alpha)8-barrel domain

7. Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [49223] (12 PDB entries)

8. Domain d3a6ob1: 3a6o B:1-120 [171824]
   Other proteins in same PDB: d3a6oa2, d3a6oa3, d3a6ob2, d3a6ob3
   automated match to d1ji2a1
   complexed with are, ca

Details for d3a6ob1

PDB Entry: 3a6o, 2.8 Å

PDB Description: Crystal structure of Thermoactinomyces vulgaris R-47 alpha-amylase 2/acarbose complex

PDB Compounds: (B:) Neopullulanase 2

SCOPe Domain Sequences for d3a6ob1:

Sequence; same for both SEQRES and ATOM records:

>d3a6ob1 b.1.18.2 (B:1-120) Maltogenic amylase, N-terminal domain N {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]}
mlleaifheakgsyaypisetqlrvrlrakkgdvvrcevlyadryaspeeelahalagka
gsderfdyfeallecstkrvkyvflltgpqgeavyfgetgfsaerskagvfqyayihrse

Timeline for d3a6ob1:

• d3a6ob1 first appeared in SCOPe 2.01
  
• d3a6ob1 appears in SCOPe 2.05
  
• d3a6ob1 appears in SCOPe 2.07
  
• d3a6ob1 appears in the current release, SCOPe 2.08