Lineage for d3a67l_ (3a67 L:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1288590Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1289217Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (213 PDB entries)
    Uniprot P01645 1-106 # 95% sequense identity; KV5L_MOUSE Ig kappa chain V-V region HP 93G7 ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! SQ NA # humanized antibody ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01642 21-115 # ! KV5I_MOUSE Ig kappa chain V-V region L7 precursor
  8. 1289234Domain d3a67l_: 3a67 L: [171771]
    Other proteins in same PDB: d3a67h_, d3a67y_
    automated match to d1c08a_
    mutant

Details for d3a67l_

PDB Entry: 3a67 (more details), 1.8 Å

PDB Description: Crystal Structure of HyHEL-10 Fv mutant LN31D complexed with hen egg white lysozyme
PDB Compounds: (L:) lysozyme binding Ig kappa chain V23-J2 region

SCOPe Domain Sequences for d3a67l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a67l_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
divltqspatlsvtpgnsvslscrasqsigdnlhwyqqkshesprllikyasqsisgips
rfsgsgsgtdftlsinsvetedfgmyfcqqsnswpytfgggtkleik

SCOPe Domain Coordinates for d3a67l_:

Click to download the PDB-style file with coordinates for d3a67l_.
(The format of our PDB-style files is described here.)

Timeline for d3a67l_: