Lineage for d3a67h_ (3a67 H:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2352672Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2353587Species Mouse (Mus musculus), cluster 7.2 [TaxId:10090] [88558] (32 PDB entries)
  8. 2353593Domain d3a67h_: 3a67 H: [171770]
    Other proteins in same PDB: d3a67l_, d3a67y_
    automated match to d1c08b_
    mutant

Details for d3a67h_

PDB Entry: 3a67 (more details), 1.8 Å

PDB Description: Crystal Structure of HyHEL-10 Fv mutant LN31D complexed with hen egg white lysozyme
PDB Compounds: (H:) IG VH, anti-lysozyme

SCOPe Domain Sequences for d3a67h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a67h_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.2 [TaxId: 10090]}
dvqlqesgpslvkpsqtlsltcsvtgdsitsdywswirkfpgnrleymgyvsysgstyyn
pslksrisitrdtsknqyyldlnsvttedtatyycanwdgdywgqgtlvtvsaa

SCOPe Domain Coordinates for d3a67h_:

Click to download the PDB-style file with coordinates for d3a67h_.
(The format of our PDB-style files is described here.)

Timeline for d3a67h_: