SCOPe 2.06: Domain d3a58f_: 3a58 F:

Lineage for d3a58f_ (3a58 F:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (29 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187069] (9 PDB entries)

8. Domain d3a58f_: 3a58 F: [171749]
   automated match to d1ow3b_
   complexed with gnp, mg, po4

Details for d3a58f_

PDB Entry: 3a58, 2.6 Å

PDB Description: crystal structure of sec3p - rho1p complex from saccharomyces cerevisiae

PDB Compounds: (F:) GTP-binding protein RHO1

SCOPe Domain Sequences for d3a58f_:

Sequence; same for both SEQRES and ATOM records:

>d3a58f_ c.37.1.8 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nsirrklvivgdgacgktcllivnskgqfpevyvptvfenyvadvevdgrrvelalwdta
gqedydrlrplsypdsnvvlicfsidlpdslenvqekwiaevlhfcqgvpiilvgckvdl
rndpqtieqlrqegqqpvtsqegqsvadqigatgyyecsaktgygvrevfeaatraslmg
k

Timeline for d3a58f_:

• d3a58f_ first appeared in SCOPe 2.01
  
• d3a58f_ appears in SCOPe 2.05
  
• d3a58f_ appears in SCOPe 2.07
  
• d3a58f_ appears in the current release, SCOPe 2.08