SCOPe 2.04: Domain d3a4sc_: 3a4s C:

Lineage for d3a4sc_ (3a4s C:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (9 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (10 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [189205] (5 PDB entries)

8. Domain d3a4sc_: 3a4s C: [171726]
   Other proteins in same PDB: d3a4sa_, d3a4sb_
   automated match to d1wm2a_
   protein/RNA complex

Details for d3a4sc_

PDB Entry: 3a4s, 2.7 Å

PDB Description: The crystal structure of the SLD2:Ubc9 complex

PDB Compounds: (C:) NFATC2-interacting protein

SCOPe Domain Sequences for d3a4sc_:

Sequence; same for both SEQRES and ATOM records:

>d3a4sc_ d.15.1.0 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qelrlrvqgkekhqmleislspdsplkvlmshyeeamglsghklsfffdgtklsgkelpa
dlglesgdlievwg

Timeline for d3a4sc_:

• d3a4sc_ first appeared in SCOPe 2.01
  
• d3a4sc_ appears in SCOPe 2.03
  
• d3a4sc_ appears in SCOPe 2.05
  
• d3a4sc_ appears in the current release, SCOPe 2.08