Lineage for d3a4rb_ (3a4r B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1892545Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1893753Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 1893754Protein automated matches [190233] (11 species)
    not a true protein
  7. 1893846Species Mouse (Mus musculus) [TaxId:10090] [189205] (6 PDB entries)
  8. 1893848Domain d3a4rb_: 3a4r B: [171723]
    automated match to d1wm2a_
    complexed with edo, so4

Details for d3a4rb_

PDB Entry: 3a4r (more details), 1 Å

PDB Description: The crystal structure of SUMO-like domain 2 in Nip45
PDB Compounds: (B:) NFATC2-interacting protein

SCOPe Domain Sequences for d3a4rb_:

Sequence, based on SEQRES records: (download)

>d3a4rb_ d.15.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gplgsqelrlrvqgkekhqmleislspdsplkvlmshyeeamglsghklsfffdgtklsg
kelpadlglesgdlievwg

Sequence, based on observed residues (ATOM records): (download)

>d3a4rb_ d.15.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gpllrlrvqgkekhqmleislspdsplkvlmshyeeamglsghklsfffdgtklsgkelp
adlglesgdlievwg

SCOPe Domain Coordinates for d3a4rb_:

Click to download the PDB-style file with coordinates for d3a4rb_.
(The format of our PDB-style files is described here.)

Timeline for d3a4rb_: