SCOPe 2.05: Domain d3a4ra_: 3a4r A:

Lineage for d3a4ra_ (3a4r A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (9 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (11 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [189205] (6 PDB entries)

8. Domain d3a4ra_: 3a4r A: [171722]
   automated match to d1wm2a_
   complexed with edo, so4

Details for d3a4ra_

PDB Entry: 3a4r, 1 Å

PDB Description: The crystal structure of SUMO-like domain 2 in Nip45

PDB Compounds: (A:) NFATC2-interacting protein

SCOPe Domain Sequences for d3a4ra_:

Sequence; same for both SEQRES and ATOM records:

>d3a4ra_ d.15.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gplgsqelrlrvqgkekhqmleislspdsplkvlmshyeeamglsghklsfffdgtklsg
kelpadlglesgdlievwg

Timeline for d3a4ra_:

• d3a4ra_ first appeared in SCOPe 2.01
  
• d3a4ra_ appears in SCOPe 2.04
  
• d3a4ra_ is called d3a4ra1 in SCOPe 2.06
  
• d3a4ra_ appears in the current release, SCOPe 2.08, called d3a4ra1